PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA12361
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 315aa    MW: 34649.6 Da    PI: 8.4692
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA12361genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.68.4e-3648108262
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                                ++++l+cprCdstntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGggr+++++++
  Tp57577_TGAC_v2_mRNA12361  48 QSEHLNCPRCDSTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGGGRKNKRSKK 108
                                57889***********************************************987777654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-204997IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3150105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.50352106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGLSSKQVIS SSGVDWKQTL LESQDLELPK PHHLMRKQQQ QQQQTQQQSE HLNCPRCDST  60
NTKFCYYNNY NKSQPRHFCR ACKRHWTKGG TLRNVPVGGG RKNKRSKKST TPVTSSTTTA  120
TTTCTTSIVA NNMNGGLNLN SNNLMIQNPL GVSDQKTIPS SLYQALIHPP SLLLQQNMMN  180
TRDLSESKDF GIGIGNDHHG NGVFTSTSSA LNLPHQNQSM IFPFSTSTSF DRTTCSSSNV  240
YYYGEEFKTM EEPAANTKPW EIPPAAAAAA AAAAAAAATT GGMEATKYWN WEDIDSLVST  300
DLKNPYWDDS DIKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1368291e-128BT136829.1 Medicago truncatula clone JCVI-FLMt-15B3 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457087.11e-139Dof domain zinc finger protein
TrEMBLA0A072UPW61e-139A0A072UPW6_MEDTR; Dof domain zinc finger protein
STRINGGLYMA15G07730.11e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-25DOF zinc finger protein 1